LSM1_HUMAN   O15116


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15116

Recommended name:U6 snRNA-associated Sm-like protein LSm1

EC number:

Alternative names:(Cancer-associated Sm-like) (Small nuclear ribonuclear CaSm)

Cleaved into:

GeneID:27257

Gene names  (primary ):LSM1

Gene names  (synonym ):CASM

Gene names  (ORF ):

Length:133

Mass:15179

Sequence:MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Tissue specificity:

Induction:

Developmental stage:

Protein families:SnRNP Sm proteins family


   💬 WhatsApp