CT451_HUMAN   Q5HYN5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5HYN5

Recommended name:Cancer/testis antigen family 45 member A1

EC number:

Alternative names:(Cancer/testis antigen 45-1) (Cancer/testis antigen 45A1)

Cleaved into:

GeneID:541466

Gene names  (primary ):CT45A1

Gene names  (synonym ):CT45-1

Gene names  (ORF ):

Length:189

Mass:21273

Sequence:MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI

Tissue specificity:Testis specific. Expressed in cancer cell lines. {ECO:0000269|PubMed:15905330}.

Induction:

Developmental stage:

Protein families:CT45 family


   💬 WhatsApp