FATE1_HUMAN   Q969F0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q969F0

Recommended name:Fetal and adult testis-expressed transcript protein

EC number:

Alternative names:(Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)

Cleaved into:

GeneID:89885

Gene names  (primary ):FATE1

Gene names  (synonym ):FATE

Gene names  (ORF ):

Length:183

Mass:20712

Sequence:MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ

Tissue specificity:Testis-specific in fetus (aged from 6 to 11 weeks). In adult, expressed predominantly in testis, with some expression in lung, heart, kidney, adrenal gland and whole brain (PubMed:11694338). Highly expressed in certain types of cancer tissues such as hepatocellular carcinoma, colon and gastric cancer. Weakly expressed in normal pancreas (PubMed:12865919). {ECO:0000269|PubMed:11694338, ECO:0000269|PubMed:12865919}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp