FHL17_HUMAN   Q9BXU8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BXU8

Recommended name:Ferritin heavy polypeptide-like 17

EC number:

Alternative names:(Cancer/testis antigen 38) (CT38)

Cleaved into:

GeneID:53940

Gene names  (primary ):FTHL17

Gene names  (synonym ):

Gene names  (ORF ):

Length:183

Mass:21142

Sequence:MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET

Tissue specificity:Testis specific. Also expressed in several cancers. {ECO:0000269|PubMed:12704671}.

Induction:

Developmental stage:

Protein families:Ferritin family


   💬 WhatsApp