MAGB5_HUMAN   Q9BZ81


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZ81

Recommended name:Melanoma-associated antigen B5

EC number:

Alternative names:(Cancer/testis antigen 3.3) (CT3.3) (MAGE-B5 antigen)

Cleaved into:

GeneID:347541

Gene names  (primary ):MAGEB5

Gene names  (synonym ):

Gene names  (ORF ):

Length:275

Mass:31906

Sequence:MTSAGVFNAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQRILKEDMLKIVNPRYQNQFAEIHRRASEHIEVVFAVDLKEVNPTCHLYDLVSKLKLPNNGRIHVGKVLPKTGLLMTFLVVIFLKGNCANKEDTWKFLDMMQIYDGKKYYIYGEPRKLITQDFVRLTYLEYHQVPCSYPAHYQFLWGPRAYTETSKMKVLEYLAKVNDIAPGAFSSQYEEALQDEEESPSQRCSRNWHYCSGQDCLRAKFSSFSQPY

Tissue specificity:Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp