DSCR8_HUMAN Q96T75
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96T75
Recommended name：Down syndrome critical region protein 8
EC number：
Alternative names：(Cancer/testis antigen 25) (CT25) (DCR1-24.0) (Malignant melanoma-associated protein 1) (MMA-1) (Protein MTAG2)
Cleaved into：
GeneID：
Gene names (primary )：DSCR8
Gene names (synonym )：C21orf65 MTAG2
Gene names (ORF )：
Length：97
Mass：10969
Sequence：MKEPGPNFVTVRKGLHSFKMAFVKHLLLFLSPRLECSGSITDHCSLHLPVQEILMSQPPEQLGLQTNLGNQESSGMMKLFMPRPKVLAQYESIQFMP
Tissue specificity：Expressed in numerous tissues; not found in breast, heart, small intestine and liver (PubMed:12036297). Isoform 1: Predominantly expressed in the testis (PubMed:11920614, PubMed:15472897). Isoform 3: Predominantly expressed in the testis, at lower level in the placenta, during malignant progression of melanocytic tumors and in several tumors of varying origins (PubMed:11920614, PubMed:15472897). Isoform 4: Predominantly expressed in the testis, at lower level in the placenta, during malignant progression of melanocytic tumors and in several tumors of varying origins (PubMed:11920614, PubMed:15472897). Isoform 5: Predominantly expressed in the testis (PubMed:11920614, PubMed:15472897). Isoform 6: Predominantly expressed in the testis (PubMed:11920614, PubMed:15472897). {ECO:0000269|PubMed:11920614, ECO:0000269|PubMed:12036297, ECO:0000269|PubMed:15472897}.
Induction：
Developmental stage：
Protein families：