SP17_HUMAN Q15506
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15506
Recommended name：Sperm surface protein Sp17
EC number：
Alternative names：(Cancer/testis antigen 22) (CT22) (Sp17-1) (Sperm autoantigenic protein 17) (Sperm protein 17)
Cleaved into：
GeneID：53340
Gene names (primary )：SPA17
Gene names (synonym )：SP17
Gene names (ORF )：
Length：151
Mass：17406
Sequence：MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Tissue specificity：Testis and sperm specific.
Induction：
Developmental stage：
Protein families：