MYOZ1_HUMAN   Q9NP98


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NP98

Recommended name:Myozenin-1

EC number:

Alternative names:(Calsarcin-2) (Filamin-, actinin- and telethonin-binding protein) (Protein FATZ)

Cleaved into:

GeneID:58529

Gene names  (primary ):MYOZ1

Gene names  (synonym ):MYOZ

Gene names  (ORF ):

Length:299

Mass:31745

Sequence:MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL

Tissue specificity:Expressed primarily in skeletal muscle. Detected at lower levels in heart, prostate and pancreas. {ECO:0000269|PubMed:10984498, ECO:0000269|PubMed:11114196, ECO:0000269|PubMed:11171996}.

Induction:

Developmental stage:

Protein families:Myozenin family


   💬 WhatsApp