CALL5_HUMAN   Q9NZT1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NZT1

Recommended name:Calmodulin-like protein 5

EC number:

Alternative names:(Calmodulin-like skin protein)

Cleaved into:

GeneID:51806

Gene names  (primary ):CALML5

Gene names  (synonym ):CLSP

Gene names  (ORF ):

Length:146

Mass:15893

Sequence:MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Tissue specificity:Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp