HPCA_HUMAN   P84074


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P84074

Recommended name:Neuron-specific calcium-binding protein hippocalcin

EC number:

Alternative names:(Calcium-binding protein BDR-2)

Cleaved into:

GeneID:3208

Gene names  (primary ):HPCA

Gene names  (synonym ):BDR2

Gene names  (ORF ):

Length:193

Mass:22427

Sequence:MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Tissue specificity:Brain specific. {ECO:0000269|PubMed:8166736}.

Induction:

Developmental stage:

Protein families:Recoverin family


   💬 WhatsApp