FLOWR_HUMAN   Q9UGQ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UGQ2

Recommended name:Calcium channel flower homolog

EC number:

Alternative names:(Calcium channel flower domain-containing protein 1)

Cleaved into:

GeneID:11094

Gene names  (primary ):CACFD1

Gene names  (synonym ):C9orf7

Gene names  (ORF ):PSEC0107 PSEC0248 UNQ3071/PRO9903

Length:172

Mass:18470

Sequence:MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Calcium channel flower family


   💬 WhatsApp