CANB2_HUMAN   Q96LZ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96LZ3

Recommended name:Calcineurin subunit B type 2

EC number:

Alternative names:(Calcineurin B-like protein) (CBLP) (Calcineurin BII) (CNBII) (PPP3R1-like) (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)

Cleaved into:

GeneID:5535

Gene names  (primary ):PPP3R2

Gene names  (synonym ):CBLP PPP3RL

Gene names  (ORF ):

Length:170

Mass:19533

Sequence:MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV

Tissue specificity:Testis-specific. {ECO:0000269|PubMed:15865209}.

Induction:

Developmental stage:

Protein families:Calcineurin regulatory subunit family


   💬 WhatsApp