XCL2_HUMAN   Q9UBD3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UBD3

Recommended name:Cytokine SCM-1 beta

EC number:

Alternative names:(C motif chemokine 2) (XC chemokine ligand 2)

Cleaved into:

GeneID:6846

Gene names  (primary ):XCL2

Gene names  (synonym ):SCYC2

Gene names  (ORF ):

Length:114

Mass:12567

Sequence:MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intercrine gamma family


   💬 WhatsApp