BAF_HUMAN O75531
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75531
Recommended name：Barrier-to-autointegration factor
EC number：
Alternative names：(Breakpoint cluster region protein 1)
Cleaved into：Barrier-to-autointegration factor, N-terminally processed
GeneID：8815
Gene names (primary )：BANF1
Gene names (synonym )：BAF BCRG1
Gene names (ORF )：
Length：89
Mass：10059
Sequence：MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Tissue specificity：Widely expressed. Expressed in colon, brain, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen and testis. Not detected in thymus and peripheral blood leukocytes.
Induction：
Developmental stage：
Protein families：BAF family