PO4F3_HUMAN Q15319
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15319
Recommended name：POU domain, class 4, transcription factor 3
EC number：
Alternative names：(Brain-specific homeobox/POU domain protein 3C) (Brain-3C) (Brn-3C)
Cleaved into：
GeneID：5459
Gene names (primary )：POU4F3
Gene names (synonym )：BRN3C
Gene names (ORF )：
Length：338
Mass：37052
Sequence：MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Tissue specificity：Brain. Seems to be specific to the retina. {ECO:0000269|PubMed:7623109, ECO:0000269|PubMed:9506947}.
Induction：
Developmental stage：
Protein families：POU transcription factor family, Class-4 subfamily