BEX2_HUMAN   Q9BXY8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BXY8

Recommended name:Protein BEX2

EC number:

Alternative names:(Brain-expressed X-linked protein 2) (hBex2)

Cleaved into:

GeneID:84707

Gene names  (primary ):BEX2

Gene names  (synonym ):

Gene names  (ORF ):

Length:128

Mass:15321

Sequence:MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP

Tissue specificity:Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines. {ECO:0000269|PubMed:15958283, ECO:0000269|PubMed:19711341}.

Induction:

Developmental stage:

Protein families:BEX family


   💬 WhatsApp