BPEC1_HUMAN   Q9GZL8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9GZL8

Recommended name:Putative BPES syndrome breakpoint region protein

EC number:

Alternative names:(BPES candidate 1)

Cleaved into:

GeneID:

Gene names  (primary ):BPESC1

Gene names  (synonym ):

Gene names  (ORF ):

Length:116

Mass:12676

Sequence:MGGRDQITNLGSEGETHPWGYSSPPYPLHTFFIPFLPSGFGGSGLGIPSDNEKHDLQDCVEVSRPEGPAPELPSSLCGWNKISSLCGLGFPSRDPKTWDLAMLLSPWVDFFELQLL

Tissue specificity:Seems to be expressed only in testis.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp