OSTCN_HUMAN   P02818


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P02818

Recommended name:Osteocalcin

EC number:

Alternative names:(Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein)

Cleaved into:

GeneID:632

Gene names  (primary ):BGLAP

Gene names  (synonym ):

Gene names  (ORF ):

Length:100

Mass:10963

Sequence:MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Osteocalcin/matrix Gla protein family


   💬 WhatsApp