BL1S1_HUMAN P78537
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P78537
Recommended name：Biogenesis of lysosome-related organelles complex 1 subunit 1
EC number：
Alternative names：(BLOC-1 subunit 1) (GCN5-like protein 1) (Protein RT14)
Cleaved into：
GeneID：2647
Gene names (primary )：BLOC1S1
Gene names (synonym )：BLOS1 GCN5L1 RT14
Gene names (ORF )：
Length：153
Mass：17263
Sequence：MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
Tissue specificity：
Induction：
Developmental stage：
Protein families：BLOC1S1 family