BL1S1_HUMAN   P78537


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P78537

Recommended name:Biogenesis of lysosome-related organelles complex 1 subunit 1

EC number:

Alternative names:(BLOC-1 subunit 1) (GCN5-like protein 1) (Protein RT14)

Cleaved into:

GeneID:2647

Gene names  (primary ):BLOC1S1

Gene names  (synonym ):BLOS1 GCN5L1 RT14

Gene names  (ORF ):

Length:153

Mass:17263

Sequence:MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

Tissue specificity:

Induction:

Developmental stage:

Protein families:BLOC1S1 family


   💬 WhatsApp