BORG1_HUMAN   O14613


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O14613

Recommended name:Cdc42 effector protein 2

EC number:

Alternative names:(Binder of Rho GTPases 1)

Cleaved into:

GeneID:10435

Gene names  (primary ):CDC42EP2

Gene names  (synonym ):BORG1 CEP2

Gene names  (ORF ):

Length:210

Mass:22484

Sequence:MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT

Tissue specificity:Highly expressed in the heart. Weakly expressed in the pancreas and liver. {ECO:0000269|PubMed:10490598}.

Induction:

Developmental stage:

Protein families:BORG/CEP family


   💬 WhatsApp