B3GNL_HUMAN Q67FW5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q67FW5
Recommended name：UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1
EC number：EC:2.4.1.-
Alternative names：(BGnT-like protein 1) (Beta1,3-N-acetylglucosaminyltransferase-like protein 1) (Beta3Gn-T-like protein 1) (Beta3GnTL1) (Beta-1,3-N-acetylglucosaminyltransferase 8) (BGnT-8) (Beta-1,3-Gn-T8) (Beta3Gn-T8)
Cleaved into：
GeneID：146712
Gene names (primary )：B3GNTL1
Gene names (synonym )：B3GNT8
Gene names (ORF )：
Length：361
Mass：40713
Sequence：MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMPTWFCSRAWFSHVGPFNEGGQGVPEDLLFFYEHLRKGGGVIRVDQSLLLYRHHPQAATHCVLETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSLTAGSQRKVVAFCDVDENKIRKGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLHLQEGQDFLHFS
Tissue specificity：Widely expressed. Highly expressed in adult pancreas. Expressed at moderate level in kidney, spleen, thymus, prostate, testis and ovary. Weakly expressed in small intestine, colon, peripheral blood leukocyte and liver. {ECO:0000269|PubMed:15560372}.
Induction：
Developmental stage：
Protein families：Glycosyltransferase 2 family