D107A_HUMAN   Q8IZN7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IZN7

Recommended name:Beta-defensin 107

EC number:

Alternative names:(Beta-defensin 7) (BD-7) (DEFB-7) (Defensin, beta 107)

Cleaved into:

GeneID:245910

Gene names  (primary ):DEFB107A; DEFB107B

Gene names  (synonym ):DEFB107 DEFB7;

Gene names  (ORF ):;

Length:70

Mass:7846

Sequence:MPGAMKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH

Tissue specificity:Specifically expressed in testis.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp