D106A_HUMAN Q8N104
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N104
Recommended name：Beta-defensin 106
EC number：
Alternative names：(Beta-defensin 6) (BD-6) (DEFB-6) (Defensin, beta 106)
Cleaved into：
GeneID：245909
Gene names (primary )：DEFB106A; DEFB106B
Gene names (synonym )：BD6 DEFB106 DEFB6;
Gene names (ORF )：;
Length：65
Mass：7369
Sequence：MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
Tissue specificity：Expressed specifically in epididymis and lung. {ECO:0000269|PubMed:12600824}.
Induction：
Developmental stage：
Protein families：Beta-defensin family