DB125_HUMAN Q8N687
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N687
Recommended name：Beta-defensin 125
EC number：
Alternative names：(Beta-defensin 25) (DEFB-25) (Defensin, beta 125)
Cleaved into：
GeneID：245938
Gene names (primary )：DEFB125
Gene names (synonym )：DEFB25
Gene names (ORF )：
Length：156
Mass：17537
Sequence：MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAFPVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Tissue specificity：
Induction：
Developmental stage：
Protein families：Beta-defensin family