DB123_HUMAN Q8N688
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N688
Recommended name：Beta-defensin 123
EC number：
Alternative names：(Beta-defensin 23) (DEFB-23) (Defensin, beta 123)
Cleaved into：
GeneID：245936
Gene names (primary )：DEFB123
Gene names (synonym )：DEFB23
Gene names (ORF )：UNQ1963/PRO4485
Length：67
Mass：8105
Sequence：MKLLLLTLTVLLLLSQLTPGGTQRCWNLYGKCRYRCSKKERVYVYCINNKMCCVKPKYQPKERWWPF
Tissue specificity：Abundant expression in the male reproductive tract only. Abundant expressed in testis and the caput region of epididymis, but low in the corpus region. {ECO:0000269|PubMed:15772680}.
Induction：
Developmental stage：
Protein families：Beta-defensin family