DB121_HUMAN   Q5J5C9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5J5C9

Recommended name:Beta-defensin 121

EC number:

Alternative names:(Beta-defensin 21) (DEFB-21) (Defensin, beta 121)

Cleaved into:

GeneID:245934

Gene names  (primary ):DEFB121

Gene names  (synonym ):DEFB21

Gene names  (ORF ):

Length:76

Mass:8456

Sequence:MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV

Tissue specificity:Abundant expression in the male reproductive tract only. {ECO:0000269|PubMed:15772680}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp