DB118_HUMAN Q96PH6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96PH6
Recommended name：Beta-defensin 118
EC number：
Alternative names：(Beta-defensin 18) (DEFB-18) (Defensin, beta 118) (Epididymal secretory protein 13.6) (ESP13.6)
Cleaved into：
GeneID：117285
Gene names (primary )：DEFB118
Gene names (synonym )：C20orf63 DEFB18 ESC42
Gene names (ORF )：
Length：123
Mass：13614
Sequence：MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS
Tissue specificity：High-level and epididymis-specific expression. Most abundant in the epithelium of the caput and is also present in the lumen and bound to sperm. Expressed also in pancreas. {ECO:0000269|PubMed:12600824}.
Induction：
Developmental stage：
Protein families：Beta-defensin family