DB116_HUMAN   Q30KQ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q30KQ4

Recommended name:Beta-defensin 116

EC number:

Alternative names:(Beta-defensin 16) (DEFB-16) (Defensin, beta 116)

Cleaved into:

GeneID:245930

Gene names  (primary ):DEFB116

Gene names  (synonym ):DEFB16

Gene names  (ORF ):

Length:102

Mass:11544

Sequence:MSVMKPCLMTIAILMILAQKTPGGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp