DB115_HUMAN   Q30KQ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q30KQ5

Recommended name:Beta-defensin 115

EC number:

Alternative names:(Beta-defensin 15) (DEFB-15) (Defensin, beta 115)

Cleaved into:

GeneID:245929

Gene names  (primary ):DEFB115

Gene names  (synonym ):DEFB15

Gene names  (ORF ):

Length:88

Mass:10071

Sequence:MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp