DB114_HUMAN   Q30KQ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q30KQ6

Recommended name:Beta-defensin 114

EC number:

Alternative names:(Beta-defensin 14) (DEFB-14) (Defensin, beta 114)

Cleaved into:

GeneID:245928

Gene names  (primary ):DEFB114

Gene names  (synonym ):DEFB14

Gene names  (ORF ):

Length:69

Mass:8318

Sequence:MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF

Tissue specificity:Expressed in epididymis, predominantly in the caput (at protein level). {ECO:0000269|PubMed:23482568}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp