TMM54_HUMAN   Q969K7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q969K7

Recommended name:Transmembrane protein 54

EC number:

Alternative names:(Beta-casein-like protein) (Protein CAC-1)

Cleaved into:

GeneID:113452

Gene names  (primary ):TMEM54

Gene names  (synonym ):BCLP CAC1

Gene names  (ORF ):

Length:222

Mass:23772

Sequence:MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTFATQGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL

Tissue specificity:Ubiquitously expressed in cancer cell lines. {ECO:0000269|PubMed:11394883}.

Induction:

Developmental stage:

Protein families:TMEM54 family


   💬 WhatsApp