CRBB3_HUMAN   P26998


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P26998

Recommended name:Beta-crystallin B3

EC number:

Alternative names:(Beta-B3 crystallin)

Cleaved into:Beta-crystallin B3, N-terminally processed

GeneID:1417

Gene names  (primary ):CRYBB3

Gene names  (synonym ):CRYB3

Gene names  (ORF ):

Length:211

Mass:24252

Sequence:MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQVESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDASQPQLQSVRRIRDQKWHKRGRFPSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Beta/gamma-crystallin family


   💬 WhatsApp