KCQ1D_HUMAN   Q9H478


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H478

Recommended name:KCNQ1 downstream neighbor protein

EC number:

Alternative names:(Beckwith-Wiedemann region transcript protein)

Cleaved into:

GeneID:

Gene names  (primary ):KCNQ1DN

Gene names  (synonym ):BWRT

Gene names  (ORF ):

Length:68

Mass:7384

Sequence:MGRKWSGPTAEHQLPMPPPGVRLDSWKGVASGCSPSKASQEARGKEKCPTLNGQPQWSALFTLPPQRE

Tissue specificity:Shows reduced expression in Wilms' tumor samples. {ECO:0000269|PubMed:11056398}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp