BDNF_HUMAN P23560
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23560
Recommended name：Brain-derived neurotrophic factor
EC number：
Alternative names：(BDNF) (Abrineurin)
Cleaved into：BDNF precursor form (ProBDNF)
GeneID：627
Gene names (primary )：BDNF
Gene names (synonym )：
Gene names (ORF )：
Length：247
Mass：27818
Sequence：MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Tissue specificity：Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. {ECO:0000269|PubMed:11152678, ECO:0000269|PubMed:17629449, ECO:0000269|PubMed:19467646, ECO:0000269|PubMed:2236018}.
Induction：
Developmental stage：
Protein families：NGF-beta family