B2L15_HUMAN   Q5TBC7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5TBC7

Recommended name:Bcl-2-like protein 15

EC number:

Alternative names:(Bcl2-L-15)

Cleaved into:

GeneID:440603

Gene names  (primary ):BCL2L15

Gene names  (synonym ):C1orf178

Gene names  (ORF ):

Length:163

Mass:17725

Sequence:MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWENLES

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp