B2L14_HUMAN   Q9BZR8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZR8

Recommended name:Apoptosis facilitator Bcl-2-like protein 14

EC number:

Alternative names:(Bcl2-L-14) (Apoptosis regulator Bcl-G)

Cleaved into:

GeneID:79370

Gene names  (primary ):BCL2L14

Gene names  (synonym ):BCLG

Gene names  (ORF ):

Length:327

Mass:36598

Sequence:MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

Tissue specificity:Isoform 1 is widely expressed. Isoform 2 is testis-specific. {ECO:0000269|PubMed:11054413}.

Induction:

Developmental stage:

Protein families:Bcl-2 family


   💬 WhatsApp