CLCF1_HUMAN   Q9UBD9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UBD9

Recommended name:Cardiotrophin-like cytokine factor 1

EC number:

Alternative names:(B-cell-stimulating factor 3) (BSF-3) (Novel neurotrophin-1) (NNT-1)

Cleaved into:

GeneID:23529

Gene names  (primary ):CLCF1

Gene names  (synonym ):BSF3 CLC NNT1

Gene names  (ORF ):

Length:225

Mass:25176

Sequence:MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Tissue specificity:Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver. {ECO:0000269|PubMed:10448081, ECO:0000269|PubMed:10500198}.

Induction:

Developmental stage:

Protein families:IL-6 superfamily


   💬 WhatsApp