TNR5_HUMAN   P25942


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P25942

Recommended name:Tumor necrosis factor receptor superfamily member 5

EC number:

Alternative names:(B-cell surface antigen CD40) (Bp50) (CD40L receptor) (CDw40) (CD antigen CD40)

Cleaved into:

GeneID:958

Gene names  (primary ):CD40

Gene names  (synonym ):TNFRSF5

Gene names  (ORF ):

Length:277

Mass:30619

Sequence:MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Tissue specificity:B-cells and in primary carcinomas.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp