VCY2_HUMAN O14599
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14599
Recommended name：Testis-specific basic protein Y 2
EC number：
Alternative names：(Basic charge, Y-linked 2) (Variably charged protein Y 2)
Cleaved into：
GeneID：442867
Gene names (primary )：BPY2; BPY2B; BPY2C
Gene names (synonym )：BPY2A VCY2 VCY2A; VCY2B; VCY2C
Gene names (ORF )：; ;
Length：106
Mass：12063
Sequence：MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
Tissue specificity：Expressed exclusively in testis. Expressed in ejaculated spermatozoa of germ cell. Expressed in the nuclei of spermatogonia, spermatocytes, and round spermatids, except elongated spermatids (at protein level). {ECO:0000269|PubMed:12207887, ECO:0000269|PubMed:12724276, ECO:0000269|PubMed:14627543}.
Induction：
Developmental stage：
Protein families：VCX/VCY family