NB5R2_HUMAN   Q6BCY4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6BCY4

Recommended name:NADH-cytochrome b5 reductase 2

EC number:EC:1.6.2.2

Alternative names:(b5R.2)

Cleaved into:

GeneID:51700

Gene names  (primary ):CYB5R2

Gene names  (synonym ):

Gene names  (ORF ):

Length:276

Mass:31458

Sequence:MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTADMIKEHLPPPAKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY

Tissue specificity:Restricted expression. {ECO:0000269|PubMed:10611283}.

Induction:

Developmental stage:

Protein families:Flavoprotein pyridine nucleotide cytochrome reductase family


   💬 WhatsApp