NB5R1_HUMAN   Q9UHQ9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UHQ9

Recommended name:NADH-cytochrome b5 reductase 1

EC number:EC:1.6.2.2

Alternative names:(b5R.1) (Humb5R2) (NAD(P)H:quinone oxidoreductase type 3 polypeptide A2)

Cleaved into:

GeneID:51706

Gene names  (primary ):CYB5R1

Gene names  (synonym ):NQO3A2

Gene names  (ORF ):UNQ3049/PRO9865

Length:305

Mass:34095

Sequence:MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:10611283}.

Induction:

Developmental stage:

Protein families:Flavoprotein pyridine nucleotide cytochrome reductase family


   💬 WhatsApp