B3AS1_HUMAN P59052
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59052
Recommended name：Putative uncharacterized protein B3GALT5-AS1
EC number：
Alternative names：(B3GALT5 antisense RNA 1) (B3GALT5 antisense gene protein 1)
Cleaved into：
GeneID：
Gene names (primary )：B3GALT5-AS1
Gene names (synonym )：C21orf88
Gene names (ORF )：
Length：145
Mass：15706
Sequence：MRRLRHREVRGPVLGHTATGGPQNGTSGCTTAPQQRPPPGTQGMLEQYLNRGGQKSHGLCWLLCFVSQGQNQDVISAELWCRIHVQAHWGCWQNSAVWGCRNEVLVSLLAVGQGLPSASGGRLPSLVHGPSHPDSQHPREVPLAL
Tissue specificity：Ubiquitous.
Induction：
Developmental stage：
Protein families：