BAGE1_HUMAN   Q13072


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13072

Recommended name:B melanoma antigen 1

EC number:

Alternative names:(B melanoma antigen) (Antigen MZ2-BA) (Cancer/testis antigen 2.1) (CT2.1)

Cleaved into:

GeneID:574

Gene names  (primary ):BAGE

Gene names  (synonym ):BAGE1

Gene names  (ORF ):

Length:43

Mass:4810

Sequence:MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF

Tissue specificity:Not expressed in normal tissues, except in testis. Expressed with significant proportion in melanomas, but also in tumors of various histological origins, such as bladder carcinomas, head and neck squamous cell carcinomas, lung and breast carcinomas. Not expressed in renal, colorectal and prostatic carcinomas, leukemias and lymphomas. More frequently expressed in metastatic melanomas than in primary melanomas.

Induction:

Developmental stage:

Protein families:BAGE family


   💬 WhatsApp