AIDA_HUMAN   Q96BJ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96BJ3

Recommended name:Axin interactor, dorsalization-associated protein

EC number:

Alternative names:(Axin interaction partner and dorsalization antagonist)

Cleaved into:

GeneID:64853

Gene names  (primary ):AIDA

Gene names  (synonym ):C1orf80

Gene names  (ORF ):

Length:306

Mass:35023

Sequence:MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE

Tissue specificity:Widely expressed in adult tissues, with highest expression in the heart and skeletal muscle. {ECO:0000269|PubMed:17681137}.

Induction:

Developmental stage:

Protein families:AIDA family


   💬 WhatsApp