CTG1B_HUMAN P78358
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P78358
Recommended name：Cancer/testis antigen 1
EC number：
Alternative names：(Autoimmunogenic cancer/testis antigen NY-ESO-1) (Cancer/testis antigen 6.1) (CT6.1) (L antigen family member 2) (LAGE-2)
Cleaved into：
GeneID：1485
Gene names (primary )：CTAG1A; CTAG1B
Gene names (synonym )：CTAG CTAG1 ESO1 LAGE2 LAGE2A; LAGE2B
Gene names (ORF )：;
Length：180
Mass：17992
Sequence：MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Tissue specificity：Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level). {ECO:0000269|PubMed:12065688}.
Induction：
Developmental stage：
Protein families：CTAG/PCC1 family