ALKL1_HUMAN   Q6UXT8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UXT8

Recommended name:ALK and LTK ligand 1

EC number:

Alternative names:(Augmentor beta) (AUG-beta) (Protein FAM150A)

Cleaved into:

GeneID:389658

Gene names  (primary ):ALKAL1

Gene names  (synonym ):FAM150A

Gene names  (ORF ):UNQ9433/PRO34745

Length:129

Mass:14269

Sequence:MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Tissue specificity:Widely expressed with highest levels in thyroid and moderate levels in stomach, trachea, small intestine, prostate and brain. {ECO:0000269|PubMed:25331893}.

Induction:

Developmental stage:

Protein families:ALKAL family


   💬 WhatsApp