ANF_HUMAN P01160
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01160
Recommended name：Natriuretic peptides A
EC number：
Alternative names：(Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF)
Cleaved into：Long-acting natriuretic peptide (LANP) (Long-acting natriuretic hormone) (LANH) (Pro atrial natriuretic factor 1-30) (proANF 1-30) (Pro atrial natriuretic peptide 1-30) (proANP 1-30); Vessel dilator (VSDL) (Pro atrial natriuretic factor 31-67) (proANF 31-67) (Pro atrial natriuretic peptide 31-67) (proANP 31-67); Kaliuretic peptide (KP) (Pro atrial natriuretic factor 79-98) (proANF 79-98) (Pro atrial natriuretic peptide 79-98) (proANP 79-98); Urodilatin (URO) (CDD 95-126) (CDD-ANP (95-126)) (Pro atrial natriuretic peptide 95-126) (proANP 95-126); Auriculin-C (Atrial natriuretic factor 1-33) (ANF 1-33); Auriculin-D (Atrial natriuretic factor 3-33) (ANF 3-33); Atrial natriuretic peptide (ANP) (Alpha-atrial natriuretic peptide) (Alpha-hANP) (Atrial natriuretic factor) (ANF) (CDD-ANF) (CDD-ANP (99-126)) (Cardionatrin) (Pro atrial natriuretic factor 99-126) (proANF 99-126); Auriculin-B (Atrial natriuretic factor 8-33) (ANF 8-33); Auriculin-A; Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II); Atriopeptin-3 (Atriopeptin III)
GeneID：4878
Gene names (primary )：NPPA
Gene names (synonym )：ANP PND
Gene names (ORF )：
Length：151
Mass：16396
Sequence：MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Tissue specificity：[Urodilatin]: Detected in the kidney distal tubular cells (at protein level) (PubMed:9794555, PubMed:8384600). Present in urine (at protein level) (PubMed:2972874, PubMed:9794555, PubMed:8351194, PubMed:8779891). {ECO:0000269|PubMed:2972874, ECO:0000269|PubMed:8351194, ECO:0000269|PubMed:8384600, ECO:0000269|PubMed:8779891, ECO:0000269|PubMed:9794555}.; [Atrial natriuretic peptide]: Detected in atrial and ventricular plasma samples, and in adipocytes (at protein level) (PubMed:22291141, PubMed:21672517). Detected in urine in one study (PubMed:8351194). However, was not detected in urine in another study (PubMed:7984506). In the brain, predominantly expressed in the gray matter with very weak expression in the white matter (at protein level) (PubMed:30534047). Localizes to astrocyte-like structures throughout the white matter, and in the cerebral vessels detected in the leptomeningeal and parenchymal vessels, and endothelium and smooth muscle layers (at protein level) (PubMed:30534047). Relatively low levels of expression in the kidneys compared to urodilatin (at protein level) (PubMed:9794555, PubMed:8384600). {ECO:0000269|PubMed:21672517, ECO:0000269|PubMed:22291141, ECO:0000269|PubMed:30534047, ECO:0000269|PubMed:7984506, ECO:0000269|PubMed:8351194, ECO:0000269|PubMed:8384600, ECO:0000269|PubMed:9794555}.
Induction：
Developmental stage：
Protein families：Natriuretic peptide family