PDZ11_HUMAN Q5EBL8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5EBL8
Recommended name：PDZ domain-containing protein 11
EC number：
Alternative names：(ATPase-interacting PDZ protein) (Plasma membrane calcium ATPase-interacting single-PDZ protein) (PMCA-interacting single-PDZ protein)
Cleaved into：
GeneID：51248
Gene names (primary )：PDZD11
Gene names (synonym )：AIPP1 PDZK11 PISP
Gene names (ORF )：HSPC227 UNQ6486/PRO21335
Length：140
Mass：16131
Sequence：MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
Tissue specificity：Widely expressed (at protein level). {ECO:0000269|PubMed:12763866}.
Induction：
Developmental stage：
Protein families：