ATP5E_HUMAN   P56381


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56381

Recommended name:ATP synthase subunit epsilon, mitochondrial

EC number:

Alternative names:(ATPase subunit epsilon) (ATP synthase F1 subunit epsilon)

Cleaved into:

GeneID:514

Gene names  (primary ):ATP5F1E

Gene names  (synonym ):ATP5E

Gene names  (ORF ):

Length:51

Mass:5780

Sequence:MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE

Tissue specificity:Ubiquitous.

Induction:

Developmental stage:

Protein families:Eukaryotic ATPase epsilon family


   💬 WhatsApp