ATP5I_HUMAN   P56385


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56385

Recommended name:ATP synthase subunit e, mitochondrial

EC number:

Alternative names:(ATPase subunit e) (ATP synthase membrane subunit e)

Cleaved into:ATP synthase subunit e, mitochondrial, N-terminally processed

GeneID:521

Gene names  (primary ):ATP5ME

Gene names  (synonym ):ATP5I ATP5K

Gene names  (ORF ):

Length:69

Mass:7933

Sequence:MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK

Tissue specificity:

Induction:

Developmental stage:

Protein families:ATPase e subunit family


   💬 WhatsApp